PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00106.114
Common NameAMTR_s00106p00142470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family SBP
Protein Properties Length: 282aa    MW: 31944.1 Da    PI: 10.1352
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00106.114genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.66.6e-42157234178
                                               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-- CS
                                       SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakh 69 
                                               +CqvegC++ l eakeyhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefDe+krsCrrrLa+h
  evm_27.model.AmTr_v1.0_scaffold00106.114 157 RCQVEGCDVGLGEAKEYHRRHKVCEMHSKAPKVVVLGLEQRFCQQCSRFHVVSEFDESKRSCRRRLAGH 225
                                               6******************************************************************** PP

                                               -----S--- CS
                                       SBP  70 nerrrkkqa 78 
                                               nerrrk+++
  evm_27.model.AmTr_v1.0_scaffold00106.114 226 NERRRKSSS 234
                                               ******975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-34153219IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.59155232IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-39156237IPR004333Transcription factor, SBP-box
PfamPF031101.6E-32158231IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MENSGCTSNP KTQQLPWELW DNPTRFDWSN AFSTPSLTST HSLTTPHSLS SQNQTTPSTL  60
SDIFLSPHPS HEIPRLLLNT HGLLSLETTP EPVRIGNLLS SSDFFSGFRE RNQGDSLTCL  120
KLGKRQYYED GRLGARHVAS FHQMGKRGKV GLSGVARCQV EGCDVGLGEA KEYHRRHKVC  180
EMHSKAPKVV VLGLEQRFCQ QCSRFHVVSE FDESKRSCRR RLAGHNERRR KSSSDSLGRS  240
SSQDWEKALT MMMFLLRLRR REKYLSTREL KYRSAFIGVA A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-34148231184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00161DAPTransfer from AT1G27360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011621379.11e-179PREDICTED: squamosa promoter-binding-like protein 9
TrEMBLW1NZN60.0W1NZN6_AMBTC; Uncharacterized protein
STRINGPOPTR_0002s14330.11e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.41e-35squamosa promoter-like 11
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]